PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009766033.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 317aa    MW: 34631.9 Da    PI: 8.3617
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009766033.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.96.1e-4040101263
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                     k++al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrn+PvGgg+rknkksss
  XP_009766033.1  40 KDQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTAGGSLRNIPVGGGSRKNKKSSS 101
                     7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-262888IPR003851Zinc finger, Dof-type
PfamPF027017.8E-344198IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1614498IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MDTAQWPQEI VVKPMEEIIQ NTNGSSKPNS CVERKVRPQK DQALNCPRCN STNTKFCYYN  60
NYSLSQPRYF CKTCRRYWTA GGSLRNIPVG GGSRKNKKSS SNSSSYSNHV NHVNNPLKKL  120
PDLVNQPSHN HDQNPSKIHI EGSQDLNLGF SSDFKTITEL IQVPNYDGSN KDNNSPSISP  180
LPPPPPSSSS SASSSSQLSA LELINGITSR GMNNNSFMSM ANISTDPNSV YNNSSGFSLP  240
SLNFSLDHGL GNAAYGNNLQ ETNTSGRFLF PFVGLKQIST TNTTNDGGNE NNRDHHQPAE  300
ESTNGFWNGM LGGGGSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754474e-73HG975447.1 Solanum pennellii chromosome ch08, complete genome.
GenBankHG9755204e-73HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766033.10.0PREDICTED: dof zinc finger protein DOF4.6-like
RefseqXP_016469483.10.0PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLM1AWI31e-140M1AWI3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000319281e-140(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64620.12e-45Dof family protein